Serratia proteamaculans: Spro_1907 Help Entry Spro_1907         CDS       T00595                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spe  Serratia proteamaculans Pathway spe00998   Biosynthesis of various antibiotics spe01100   Metabolic pathways spe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spro_1907    00074 Mycolic acid biosynthesis     Spro_1907   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spro_1907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ABV41010 UniProt:  A8GD20 LinkDB All DBs Position 2090937..2091173 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcagttgggtgttaaacag gaagaagttttaaataacgcttctttcgttgaagatctgggtgctgattctcttgacacc gttgagctggtaatggctctggaagaagagttcgacacagagattccagacgaagaagct gagaaaatcactactgttcaggcagctattgatttcatcaacgccagccagcagtaa

DBGET integrated database retrieval system