Serratia proteamaculans: Spro_2972 Help Entry Spro_2972         CDS       T00595                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism spe  Serratia proteamaculans Pathway spe02020   Two-component system spe02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:spe00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Spro_2972  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Spro_2972  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:spe02035]     Spro_2972 Bacterial motility proteins [BR:spe02035]  Flagellar system   Flagellar assembly proteins    Others     Spro_2972 SSDB OrthologParalogGFIT Motif Pfam:  FlgM SMP1 HTH_GRAD Motif Other DBs NCBI-ProteinID:  ABV42073 UniProt:  A8GG33 LinkDB All DBs Position 3270112..3270438 Genome browser AA seq 108 aa AA seqDB search MSIDRTQRLQPVPTVQARETPAENQLQPRKTAQTESAVSGTQVKLSDAQARLMQPGTQDI DMNRVDAIKQAIRNGELKMDAGKIADALLQDVQSDAQWMSNGNPSPKV NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgagtatcgatcgcacccagcggctgcaacccgttcccacggtgcaagcgcgtgagacg ccggcggagaatcaacttcagccacgtaaaaccgcacagacggaaagcgccgtcagcggc acccaggtaaaattgagcgacgcgcaagcgcgcctgatgcaaccgggaacgcaggatatt gatatgaaccgggtggacgccatcaaacaggcgattcgcaacggcgaactgaaaatggat gccggcaaaattgccgatgcattgctgcaggacgtgcaaagcgatgcccagtggatgtcg aacggcaacccatcgccaaaggtttga

DBGET integrated database retrieval system