Sphingopyxis sp. EG6: SPYCW_1069 Help Entry SPYCW_1069        CDS       T10392                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism speg  Sphingopyxis sp. EG6 Pathway speg01100   Metabolic pathways speg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:speg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPYCW_1069 (acpP)    00074 Mycolic acid biosynthesis     SPYCW_1069 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPYCW_1069 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  BBB08053 LinkDB All DBs Position 1084949..1085185 Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaagaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaggaagcgagcttcatcgacgatctcggcgccgacagcctcgacatc gtcgaactggtgatggcatttgaagaagaattcggcgtcgaaattcccgacgatgcggcg gaaaagatcgccaccgtcaaggatgcgatcgactatatcgaagcgaacaagggctga

DBGET integrated database retrieval system