Sphingopyxis sp. EG6: SPYCW_3166 Help Entry SPYCW_3166        CDS       T10392                                  Name (GenBank) flagellar hook capping protein   KO K02389   flagellar basal-body rod modification protein FlgD Organism speg  Sphingopyxis sp. EG6 Pathway speg02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:speg00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SPYCW_3166  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:speg02035]     SPYCW_3166 Bacterial motility proteins [BR:speg02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     SPYCW_3166 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgD Motif Other DBs NCBI-ProteinID:  BBB10150 UniProt:  A0A2Z5UH31 LinkDB All DBs Position complement(3267931..3268236) Genome browser AA seq 101 aa AA seqDB search MAVNSVTNANNVVLQPKGAGQQMGQGDFLRLMTAQLSQQDPFNPVDNQQMVAQMAQFSSL AGISETNTTLQQISEQLAAQTQLLKDIKAATPAPTPTTQEG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggccgtcaacagcgtcaccaacgccaacaatgtcgtgcttcagccgaagggcgccggg cagcagatggggcagggcgattttctgcgcctgatgaccgcgcagctgtcgcagcaggat ccgttcaaccccgtcgataaccagcagatggttgcgcagatggcgcaattctccagcctc gctgggatcagcgaaaccaacacgacgctgcaacagatttccgaacagctcgcggcgcag acccagctgctcaaagacatcaaggccgccaccccggcgccgacccccaccacgcaggaa ggataa

DBGET integrated database retrieval system