Streptococcus periodonticum: EHW89_02970 Help Entry EHW89_02970       CDS       T06568                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism spei  Streptococcus periodonticum Pathway spei00190   Oxidative phosphorylation spei01100   Metabolic pathways Module spei_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spei00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EHW89_02970  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spei00194]     EHW89_02970 Photosynthesis proteins [BR:spei00194]  Photosystem and electron transport system   F-type ATPase [OT]    EHW89_02970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AZQ41479 UniProt:  A0A3Q9EXY0 LinkDB All DBs Position 614796..614996 Genome browser AA seq 66 aa AA seqDB search MNLTFFGLCLACMGVSLAEGFLMANLFKSASRQPEIIGQLRTLMIMGIAFIEGTFFVTLA MSFIIK NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgaatttaacattttttggattatgtcttgcctgtatgggtgtttcactcgctgaaggt tttttaatggcaaatctatttaaatcagcatcacgtcaaccagaaatcattggtcagttg agaacgcttatgatcatggggattgcctttatcgaaggtactttcttcgtaacacttgcg atgtcattcatcattaaataa

DBGET integrated database retrieval system