Solanum pennellii: 107001688 Help Entry 107001688         CDS       T04130                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism spen  Solanum pennellii Pathway spen03083   Polycomb repressive complex spen04120   Ubiquitin mediated proteolysis spen04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:spen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107001688    04120 Ubiquitin mediated proteolysis     107001688   09126 Chromosome    03083 Polycomb repressive complex     107001688  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107001688    04121 Ubiquitin system [BR:spen04121]     107001688    03036 Chromosome and associated proteins [BR:spen03036]     107001688 Membrane trafficking [BR:spen04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107001688 Ubiquitin system [BR:spen04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107001688    Cul7 complex      107001688 Chromosome and associated proteins [BR:spen03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107001688   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107001688 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Ribosomal_L7Ae DUF5888 Motif Other DBs NCBI-GeneID:  107001688 NCBI-ProteinID:  XP_015055132 LinkDB All DBs Position 10:67932314..67934853 Genome browser AA seq 150 aa AA seqDB search MIVLRSSNGETFEVDEAVALESQTIKHMIEDGCADTNIPLPNVTSKILAKVIEYCKRHVE VAKAEDKTAEEDLKTFDAEFVKVDQSTLFNLILAANYLNIKSLLDLTCQTVVDMIKGKTL EEIRKIFNIKNDFTPEEEEEVRRENAWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgatcgttttgagaagctccaatggagagacctttgaggtcgatgaggcggtggcgctg gaatcgcagaccattaagcatatgatagaggatggctgcgctgacaccaacatccctctg cccaacgttactagcaagattttagccaaggtcattgaatactgcaagcgccatgtggag gttgctaaagctgaggataagactgctgaagaggatctcaagacttttgatgctgaattc gttaaagttgatcagagcacccttttcaatctcattctggctgccaactatttgaacatc aagagcttgctggatctgacatgtcagacagtagtagacatgatcaagggaaagacgctt gaagagatacgaaagatattcaacatcaagaatgacttcactcctgaagaagaggaagaa gtcaggagggagaatgcctgggcattcgagtga

DBGET integrated database retrieval system