Solanum pennellii: 107008217 Help Entry 107008217         CDS       T04130                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism spen  Solanum pennellii Pathway spen04145   Phagosome spen04148   Efferocytosis spen04517   IgSF CAM signaling spen04518   Integrin signaling spen04620   Toll-like receptor signaling pathway spen05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:spen00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107008217    04518 Integrin signaling     107008217  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107008217    04148 Efferocytosis     107008217  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107008217  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107008217  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107008217   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spen04147]     107008217    04031 GTP-binding proteins [BR:spen04031]     107008217 Membrane trafficking [BR:spen04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107008217  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107008217   Macropinocytosis    Ras GTPases     107008217  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107008217 Exosome [BR:spen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107008217   Exosomal proteins of other body fluids (saliva and urine)    107008217   Exosomal proteins of colorectal cancer cells    107008217   Exosomal proteins of bladder cancer cells    107008217 GTP-binding proteins [BR:spen04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107008217 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  107008217 NCBI-ProteinID:  XP_015062639 UniProt:  A0ABM1UVU3 LinkDB All DBs Position 1:108622815..108628267 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggtttataaagtgtgttactgtcggcgatggagctgtgggtaaaact tgtcttctcatttcgtataccagcaacacttttcccactgattatgtcccaactgttttt gacaattttagtgcaaatgtggttgtcgatgggagcactgttaatctggggctctgggat actgcaggtcaggaggattacaatagattaagacctttgagctatcgtggggcagatgta tttatactggcattttctctcattagcaaggcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataagcaattctttgtggaccatccaggtgctgttccacttagcaca gctcagggtgaggagctgagaaagtcgattggtgctgctgcttacattgaatgtagtgca aaaactcaacagaacattaaggctgtttttgatgccgccattaaggtggtcctacaacca cccaagcaaaagaagaagaagaagagaaagggtcagaaagcctgctctatcttgtga

DBGET integrated database retrieval system