Solanum pennellii: 107013755 Help Entry 107013755         CDS       T04130                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism spen  Solanum pennellii Pathway spen04145   Phagosome spen04148   Efferocytosis spen04620   Toll-like receptor signaling pathway spen05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:spen00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107013755    04148 Efferocytosis     107013755  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107013755  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107013755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107013755   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spen04147]     107013755    04031 GTP-binding proteins [BR:spen04031]     107013755 Membrane trafficking [BR:spen04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107013755  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107013755   Macropinocytosis    Ras GTPases     107013755  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107013755 Exosome [BR:spen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107013755   Exosomal proteins of other body fluids (saliva and urine)    107013755   Exosomal proteins of colorectal cancer cells    107013755   Exosomal proteins of bladder cancer cells    107013755 GTP-binding proteins [BR:spen04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107013755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  107013755 NCBI-ProteinID:  XP_015069122 LinkDB All DBs Position 1:93673880..93677709 Genome browser AA seq 208 aa AA seqDB search MNSSTSASNNATTTGTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVN VDGKIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRHYA PSVPIVLVGTKLDLREDKQFIRDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNVKA VFDTAIKVVLQPPKTKKQKRKHKACWIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaatagtagtactagtgctagtaataatgctacaacaactggaacaaagttcatcaaa tgtgttactgttggagatggtgctgttggaaaaacttgtcttctcatctcctacactagc aacactttccccactgattatgtgccaactgtttttgacaatttcagtgccaatgttaat gttgatgggaagattgtgaatcttggcctgtgggatactgctggtcaagaggattataac aggcttaggcctcttagttatcgaggagccgatgtcttcctgcttgctttctctctcata agtaggcctagctttgaaaacatatcaaaaaagtgggttcctgagctaagacattatgcc ccatcagtgcctattgttctagtggggactaaattggatttaagagaggacaagcaattt ataagggactatcctggtgcatgtacaatttcaacagaacagggtgaagaactgaaaaaa caaataggcgcagtggcttatgttgagtgcagtgctaagacgcagcagaatgtgaaggct gtttttgatactgcaatcaaggtagttcttcagcctccaaagaccaaaaaacagaaaagg aaacacaaagcctgctggatactttga

DBGET integrated database retrieval system