Solanum pennellii: 107013755 Help Entry 107013755         CDS       T04130                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism spen  Solanum pennellii Pathway spen04145   Phagosome spen04148   Efferocytosis spen04517   IgSF CAM signaling spen04518   Integrin signaling spen04620   Toll-like receptor signaling pathway spen05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:spen00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107013755    04518 Integrin signaling     107013755  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107013755    04148 Efferocytosis     107013755  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107013755  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107013755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107013755   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spen04147]     107013755    04031 GTP-binding proteins [BR:spen04031]     107013755 Membrane trafficking [BR:spen04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107013755  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107013755   Macropinocytosis    Ras GTPases     107013755  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107013755 Exosome [BR:spen04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107013755   Exosomal proteins of other body fluids (saliva and urine)    107013755   Exosomal proteins of colorectal cancer cells    107013755   Exosomal proteins of bladder cancer cells    107013755 GTP-binding proteins [BR:spen04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107013755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  107013755 NCBI-ProteinID:  XP_015069122 UniProt:  A0ABM1GCD1 LinkDB All DBs Position 1:93673880..93677709 Genome browser AA seq 208 aa AA seqDB search MNSSTSASNNATTTGTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVN VDGKIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRHYA PSVPIVLVGTKLDLREDKQFIRDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNVKA VFDTAIKVVLQPPKTKKQKRKHKACWIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaatagtagtactagtgctagtaataatgctacaacaactggaacaaagttcatcaaa tgtgttactgttggagatggtgctgttggaaaaacttgtcttctcatctcctacactagc aacactttccccactgattatgtgccaactgtttttgacaatttcagtgccaatgttaat gttgatgggaagattgtgaatcttggcctgtgggatactgctggtcaagaggattataac aggcttaggcctcttagttatcgaggagccgatgtcttcctgcttgctttctctctcata agtaggcctagctttgaaaacatatcaaaaaagtgggttcctgagctaagacattatgcc ccatcagtgcctattgttctagtggggactaaattggatttaagagaggacaagcaattt ataagggactatcctggtgcatgtacaatttcaacagaacagggtgaagaactgaaaaaa caaataggcgcagtggcttatgttgagtgcagtgctaagacgcagcagaatgtgaaggct gtttttgatactgcaatcaaggtagttcttcagcctccaaagaccaaaaaacagaaaagg aaacacaaagcctgctggatactttga

DBGET integrated database retrieval system