Solanum pennellii: 107014072 Help Entry 107014072         CDS       T04130                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism spen  Solanum pennellii Pathway spen03083   Polycomb repressive complex spen04120   Ubiquitin mediated proteolysis spen04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:spen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107014072    04120 Ubiquitin mediated proteolysis     107014072   09126 Chromosome    03083 Polycomb repressive complex     107014072  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107014072    04121 Ubiquitin system [BR:spen04121]     107014072    03036 Chromosome and associated proteins [BR:spen03036]     107014072 Membrane trafficking [BR:spen04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107014072 Ubiquitin system [BR:spen04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107014072    Cul7 complex      107014072 Chromosome and associated proteins [BR:spen03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107014072   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107014072 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ APG12 RNA_pol_Rpb2_2 Motif Other DBs NCBI-GeneID:  107014072 NCBI-ProteinID:  XP_015069421 LinkDB All DBs Position 3:56433050..56433542 Genome browser AA seq 151 aa AA seqDB search MSSLTKFLNLKTCDGKEFVLDETIAVRSETIKNMVEDNCVSNVIPLPNVDSKTMTKIIEY WKKHLEEDVSKDLLMEFDKAFVKVHHSILHVLILAANFLNDKEILYMMCQEVADRIKGKT PEEVRKEFDIKNDFTPEEEEEIRKENVWAFE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttctttaacaaagtttttaaatctaaagacttgtgatggaaaagaatttgtgctt gatgagacaatagctgtaaggtcagaaactatcaagaatatggttgaggacaattgtgtt tcaaacgtcattcccctgcctaatgtcgatagcaaaacaatgaccaaaataattgaatac tggaaaaaacatttggaggaagacgtctccaaagacctattgatggagtttgacaaggct ttcgtgaaggtgcaccactcgattttgcatgttcttatcttagctgcaaattttcttaac gataaggagatattgtatatgatgtgtcaagaagttgccgatagaattaaagggaaaaca ccagaagaagtacgtaaagaatttgatatcaagaatgattttactcccgaggaagaagag gagatccgtaaagagaatgtttgggcttttgaatag

DBGET integrated database retrieval system