Solanum pennellii: 107022876 Help Entry 107022876         CDS       T04130                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism spen  Solanum pennellii Pathway spen03083   Polycomb repressive complex spen04120   Ubiquitin mediated proteolysis spen04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:spen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107022876    04120 Ubiquitin mediated proteolysis     107022876   09126 Chromosome    03083 Polycomb repressive complex     107022876  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107022876    04121 Ubiquitin system [BR:spen04121]     107022876    03036 Chromosome and associated proteins [BR:spen03036]     107022876 Membrane trafficking [BR:spen04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107022876 Ubiquitin system [BR:spen04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107022876    Cul7 complex      107022876 Chromosome and associated proteins [BR:spen03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107022876   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107022876 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  107022876 NCBI-ProteinID:  XP_015078940 LinkDB All DBs Position 6:1249568..1250087 Genome browser AA seq 151 aa AA seqDB search MSSSTKFLTLKTCDGEEFVLEEAIAMRSQTIKNMVEDDCVSNGIPLPNVDSKTMTKVIEY WKKHSEEDVTKDTLREFDKAFVKVHHSILYDVILAANFLNDKEILDMMCQEVADRIKGKK PEEIRKEFDIKNDFTPEEEEEIRKENVWAFE NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttcaacaaagttcttaactctaaagacttgcgatggtgaggaatttgtactc gaggaggcgatagctatgagatcacaaactatcaagaatatggttgaggacgattgtgtt tcaaacggcattcccctacctaatgtcgatagcaaaacaatgaccaaagtgattgaatac tggaagaaacattcagaggaagacgtcaccaaagacacgttgagggagtttgacaaagct tttgtaaaggtgcaccactcgattttgtatgatgttatcttagctgctaattttcttaac gataaggagatattggatatgatgtgtcaagaagttgccgataggattaaagggaaaaaa ccagaagaaatacgtaaagaatttgatatcaagaatgattttactccagaagaagaagag gagatccgtaaagagaatgtttgggcttttgaatga

DBGET integrated database retrieval system