Solanum pennellii: 107032074 Help Entry 107032074         CDS       T04130                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism spen  Solanum pennellii Pathway spen03083   Polycomb repressive complex spen04120   Ubiquitin mediated proteolysis spen04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:spen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107032074    04120 Ubiquitin mediated proteolysis     107032074   09126 Chromosome    03083 Polycomb repressive complex     107032074  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spen04131]     107032074    04121 Ubiquitin system [BR:spen04121]     107032074    03036 Chromosome and associated proteins [BR:spen03036]     107032074 Membrane trafficking [BR:spen04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107032074 Ubiquitin system [BR:spen04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107032074    Cul7 complex      107032074 Chromosome and associated proteins [BR:spen03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107032074   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107032074 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  107032074 NCBI-ProteinID:  XP_015089135 UniProt:  A0ABM1HR38 LinkDB All DBs Position 10:67956724..67964035 Genome browser AA seq 149 aa AA seqDB search MIILRSFDGKTFEVDEAVALELETIKHMIEDDCAKNTIHVPNVTGKILAKVIEYCKRHVE VSKAEDKTAKEDLKTFDAEFVKVDQGTLFNLMLAANYLNIKCMLDLTCQTVADMIKEKTP EEIRKTFNIENDFTLEEEEEIRRENAWAG NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgatcattttgaggagcttcgacggcaagacctttgaggtcgatgaggcggtggcgcta gaattggagacgattaaacatatgatagaggatgactgcgctaagaacaccatccatgta ccaaacgttactggaaagatcttagccaaggtcatcgaatactgcaagcgccatgtggag gtttctaaagctgaagataagactgctaaagaggatcttaagacttttgatgctgaattc gtcaaagttgaccagggcacccttttcaatctcatgctggctgccaactacttaaacata aagtgcatgcttgacctgacatgtcagacagttgctgacatgatcaaagagaagacccct gaagagatacgtaagacattcaacatcgagaacgacttcactcttgaggaagaggaagaa atcaggagggagaatgcttgggcaggctag

DBGET integrated database retrieval system