Solanum pennellii: 34925923 Help Entry 34925923          CDS       T04130                                  Symbol atpH, CK826_pgp082 Name (RefSeq) ATP synthase CF0 subunit III   KO K02110   F-type H+-transporting ATPase subunit c Organism spen  Solanum pennellii Pathway spen00190   Oxidative phosphorylation spen00195   Photosynthesis spen01100   Metabolic pathways Module spen_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spen00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     34925923 (atpH)    00195 Photosynthesis     34925923 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spen00194]     34925923 (atpH) Photosynthesis proteins [BR:spen00194]  Photosystem and electron transport system   F-type ATPase [OT]    34925923 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  34925923 NCBI-ProteinID:  YP_009421344 UniProt:  A0A223A6U9 LinkDB All DBs Position CP Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctggattggccgtagggcttgct tctattggacctggagttggtcaagggactgctgcgggtcaagctgtagagggtatcgcg agacagcctgaggcagagggcaaaatacgaggtacgctattgcttagtctagcttttatg gaagctttaacaatttatggactggttgtagcattagcacttttatttgcaaatcctttt gtttaa

DBGET integrated database retrieval system