Streptomyces peucetius subsp. caesius: CGZ69_03970 Help Entry CGZ69_03970       CDS       T07792                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism speu  Streptomyces peucetius subsp. caesius Pathway speu03060   Protein export speu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:speu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CGZ69_03970  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CGZ69_03970  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:speu02044]     CGZ69_03970 Secretion system [BR:speu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CGZ69_03970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Phi-29_GP3 Motif Other DBs NCBI-ProteinID:  ATW47234 LinkDB All DBs Position 874317..874577 Genome browser AA seq 86 aa AA seqDB search MFGLSELAILLIVILIVFGAKKLPELARNAGKAARILKSEAKAMKTQEHAADGSQQPARI IQGQPVDGTGAQPSSGNPTADRPTRP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgttcggactcagcgagctcgcaatacttctgatcgtcatcctcatcgtgttcggcgcg aagaagctcccggaactggcccgcaacgcgggcaaggcggcacgcatcctcaagagcgaa gccaaggccatgaagacacaggagcacgcggcggacggctctcagcagccggcccgcatc atccaagggcaaccggtcgacggcactggcgcccagccgagcagcggcaacccaacagcc gacaggcccacacggccctga

DBGET integrated database retrieval system