Streptomyces peucetius subsp. caesius: CGZ69_11015 Help Entry CGZ69_11015       CDS       T07792                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism speu  Streptomyces peucetius subsp. caesius Pathway speu00998   Biosynthesis of various antibiotics speu01100   Metabolic pathways speu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:speu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CGZ69_11015    00074 Mycolic acid biosynthesis     CGZ69_11015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CGZ69_11015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ATW48380 LinkDB All DBs Position 2405930..2406178 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcgaaggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtccagctggacaagtccttcaccgacgaccttgacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgaggacgtcaagaacctgaagaccgtcggcgacgccgcggactacatcctcaagcac caggcctga

DBGET integrated database retrieval system