KEGG   Streptomyces peucetius subsp. caesius: CGZ69_24330
Entry
CGZ69_24330       CDS       T07792                                 
Name
(GenBank) cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
speu  Streptomyces peucetius subsp. caesius
Pathway
speu01056  Biosynthesis of type II polyketide backbone
speu01100  Metabolic pathways
speu01110  Biosynthesis of secondary metabolites
Module
speu_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:speu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    CGZ69_24330
Enzymes [BR:speu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     CGZ69_24330
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc AHSA1
Other DBs
NCBI-ProteinID: ATW50539
UniProt: A0A2D3UDS9
LinkDB
Position
5294272..5295219
AA seq 315 aa
MSELPLQQTEHEIHTSAAPDAVFAVLADARAWPAVFPPSVHVEQVEHTGSSERIRIWATA
NGSLRTWTSRRELDERARRIRFRQEVSAHPVAAMGGEWIVEEAGDGGTRVRLTHDFRAVD
DDPETIGWIHRAVDRNSEAELASLRTALERPDGTAPTTFEDTVVVRGRAEDVYDFLHRSD
LWKKRLSHVARIAVKEEEPGLQHMEMDTLTADGSVHTTASVRVCFPERRVIVYKQLRTPP
LLALHLGRWSVRPADDGDGIAVTSAHTVSVARSAIPGVLGAGASETDAVDFVRRALGRNS
LLTLEAARQYAESSA
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtccgagttgccgcttcagcagaccgagcacgagatccacacctccgccgcgccggac
gccgtgttcgccgtgctggccgacgcacgggcctggcccgccgtgttcccgcccagtgtc
cacgtcgaacaggtcgagcacaccggctccagcgagcgcatccgcatctgggccaccgcc
aacggctcgctgcgcacctggacgtcgcggcgcgagctcgacgagcgggcccggcgcatc
cgtttccggcaggaggtgtccgcccatcccgtcgccgccatgggcggcgaatggatcgtc
gaggaagccggcgacggcggcacccgggtgcggctgacgcacgacttccgggccgtggac
gacgacccggagacgatcggctggatccaccgggccgtggaccgcaacagcgaagcggaa
ctggcgtccctgcgcaccgcgctggaacgacccgacggcaccgcgccgacgaccttcgag
gacaccgtcgtcgtccgcggccgtgccgaggacgtctacgacttcctccaccgcagcgac
ctctggaagaagcggctctcccacgtcgcgcggatcgcggtcaaggaggaggaaccgggg
ctccagcacatggagatggacaccctcaccgcggacggctcggtgcacaccaccgcgtcg
gtgcgagtgtgcttccccgaacgccgcgtcatcgtctacaagcagctgcgcacgccgccg
ctgctcgcgctccatctcggccgttggtcggtccgtcccgccgacgacggggacgggatc
gccgtcacgtcggcccacaccgtgtccgtggcccgctcggcgatccccggcgtcctcggt
gcgggggcgagtgagacggacgccgtggacttcgtccgccgggccctgggccgcaacagt
ctgctgaccctggaagcggccaggcagtacgccgagtccagcgcctga

DBGET integrated database retrieval system