KEGG   Sphingopyxis sp. FD7: SPYCA_1269
Entry
SPYCA_1269        CDS       T10393                                 
Symbol
petB
Name
(GenBank) ubiquinol-cytochrome c reductase
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
spfd  Sphingopyxis sp. FD7
Pathway
spfd00190  Oxidative phosphorylation
spfd01100  Metabolic pathways
spfd02020  Two-component system
Module
spfd_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:spfd00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPYCA_1269 (petB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPYCA_1269 (petB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spfd03029]
    SPYCA_1269 (petB)
Mitochondrial biogenesis [BR:spfd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    SPYCA_1269 (petB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Other DBs
NCBI-ProteinID: BBB12011
LinkDB
Position
complement(1356023..1357303)
AA seq 426 aa
MSFPWAKQYEPRQPLMKWLDEKLPLPRLVYNAIGAGYPVPRNLNYFWNFGVLAGAALVIQ
IVTGIVLAMHYAANAGVAFNSVEHIMRDVNAGWFIRYAHMNGASMFFIVVYLHIFRGLYY
GSYKAPREMVWLLGVVIFLLMMATAFMGYVLPWGQMSFWGAQVITGFFSAIPIVGEPIRQ
WLLGGFAPDNAALNRFFSLHYLLPFVIAGVIILHIWALHIPGSNNPTGIEVKDEQDTVPF
HPYYTAKDGFGVGVFLLVFAALTFFTPNLLGHADNYIPANPLSTPAHIVPEWYFWPFYAI
LRAFTFNFLWIDAKLWGVIAMFAAIALLFFLPWLDSSPVKSSTYRPLYRIFFWVLVADVV
LLAICGKMPAEQPWVILSQIGSIYYFAHFLIILPIVSRIERPLPMPNSITEAVLAKHADD
KSAATA
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgagctttccctgggccaagcaatatgaaccccggcagccgctgatgaagtggctggac
gagaagctgccgctgccgcgcctcgtctataatgcgatcggcgccggttatccggtgccg
cgcaacctcaactatttctggaacttcggcgttctcgccggcgccgcgctggtgatccag
atcgtcaccggcatcgtgctcgcgatgcactatgccgccaatgccggggtcgccttcaat
tcggtcgagcatatcatgcgcgacgtcaacgccggctggttcatccgctatgcgcatatg
aacggcgcgagcatgttcttcatcgtcgtctatctgcacattttccgcggcctttattac
gggtcgtacaaggcgccgcgcgaaatggtgtggttgctcggcgtcgtgatcttcctgttg
atgatggcgaccgccttcatgggctatgtgcttccctggggccagatgagcttctggggc
gcgcaggtcattaccggcttcttctcggcgatcccgatcgtcggcgagccgatccgccag
tggctgctcggcggctttgcgcccgacaatgcggcgctcaaccgcttcttctcgttgcac
tatctgctgcccttcgtgattgcgggggtcatcatcctgcacatctgggcgctgcacatt
ccggggtcgaacaaccccacggggatcgaggtgaaggacgaacaggacaccgttcccttc
catccctattacacggcgaaggacggtttcggcgtcggcgttttcctgctcgtctttgcg
gcgctgaccttcttcacgccgaacctgcttggccacgccgacaattatatcccggcgaac
ccgctttcgactcccgcgcacatcgtacccgaatggtatttctggcccttctacgcgatc
ctgcgcgccttcactttcaacttcctgtggatcgacgcgaaactgtggggcgttatcgcg
atgttcgcggcgatcgcgctgctcttcttcctgccctggctcgacagctcgccggtgaag
tcgtcgacctatcgcccgctttatcgcatcttcttctgggtgctggtggccgacgtcgtg
ctgctcgcaatctgtggcaagatgcccgcggaacagccttgggtcatcctcagccagatt
ggctccatctattatttcgcgcacttcctgatcattctgccgatcgtgtcacgcatcgag
cgacctctgccgatgcccaactcgatcacggaagcggtccttgcaaagcatgccgacgac
aagtcggcggccacggcctga

DBGET integrated database retrieval system