Sphingopyxis sp. FD7: SPYCA_1774 Help Entry SPYCA_1774        CDS       T10393                                  Name (GenBank) nucleoid DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism spfd  Sphingopyxis sp. FD7 Brite KEGG Orthology (KO) [BR:spfd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:spfd03032]     SPYCA_1774    03036 Chromosome and associated proteins [BR:spfd03036]     SPYCA_1774    03400 DNA repair and recombination proteins [BR:spfd03400]     SPYCA_1774 DNA replication proteins [BR:spfd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SPYCA_1774 Chromosome and associated proteins [BR:spfd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SPYCA_1774 DNA repair and recombination proteins [BR:spfd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SPYCA_1774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Peptidase_M35 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  BBB12516 UniProt:  A0A2Z5UM58 LinkDB All DBs Position complement(1887688..1887960) Genome browser AA seq 90 aa AA seqDB search MNKQDLIAAVADSSGLTKGDASKAVEAVFDAITGALKKGGEVRLVGFGTFAVSKRKASTG RNPRTGETMTIAASNQPKFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagacctgatcgccgccgtcgccgattcgagcggcctgaccaagggtgat gccagcaaggccgtcgaagccgtcttcgacgcgatcacgggcgcgctgaagaagggcggc gaagtccgtctcgttggcttcggcaccttcgcggtcagcaagcgcaaggcgtcgaccggc cgcaacccgcgcaccggtgaaacgatgaccatcgcggcgtcgaaccagccgaagttcaag gccggcaaggccctcaaggacgccgtcaactaa

DBGET integrated database retrieval system