Sphingopyxis sp. FD7: SPYCA_2386 Help Entry SPYCA_2386        CDS       T10393                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spfd  Sphingopyxis sp. FD7 Pathway spfd01100   Metabolic pathways spfd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spfd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPYCA_2386 (acpP)    00074 Mycolic acid biosynthesis     SPYCA_2386 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPYCA_2386 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  BBB13128 LinkDB All DBs Position complement(2510536..2510772) Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaaaaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaagaagcgagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactggtgatggcgttcgaggaagaattcggggtcgaaatccctgacgatgcggcg gaaaagatcgccaccgtcaaggacgcgatcgactatatcgaagcgaacaagggctaa

DBGET integrated database retrieval system