Sphingomonas paeninsulae: D3Y57_18820 Help Entry D3Y57_18820       CDS       T05706                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spha  Sphingomonas paeninsulae Pathway spha01100   Metabolic pathways spha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D3Y57_18820    00074 Mycolic acid biosynthesis     D3Y57_18820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D3Y57_18820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AYJ87598 UniProt:  A0A494TQ55 LinkDB All DBs Position 2729161..2729397 Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVDADKVTEESSFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAISFIDANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaccgggttaagaagattgtcgtagagcatctcggtgtcgatgcc gacaaggtgaccgaagaatcgagtttcatcgacgatctgggcgcagacagccttgatatc gttgaacttgttatggccttcgaagaagaatttggtgtcgagattcctgacgacgcggct gaaaagatcacgaccgttaaggacgcgatcagcttcatagacgctaacaagggctga

DBGET integrated database retrieval system