Sphingobium sp. EP60837: EP837_00290 Help Entry EP837_00290       CDS       T04432                                  Name (GenBank) DNA-binding protein HRL18   KO K03530   DNA-binding protein HU-beta Organism sphb  Sphingobium sp. EP60837 Brite KEGG Orthology (KO) [BR:sphb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sphb03032]     EP837_00290    03036 Chromosome and associated proteins [BR:sphb03036]     EP837_00290    03400 DNA repair and recombination proteins [BR:sphb03400]     EP837_00290 DNA replication proteins [BR:sphb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EP837_00290 Chromosome and associated proteins [BR:sphb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EP837_00290 DNA repair and recombination proteins [BR:sphb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EP837_00290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Glyco_transf_29 Motif Other DBs NCBI-ProteinID:  ANI76737 UniProt:  A0A173KSA6 LinkDB All DBs Position 1:complement(317275..317547) Genome browser AA seq 90 aa AA seqDB search MNKQDLISAVAESSGLSKSDASKAVEGVFDSISAALKKGDEVRLVGFGTFSVSQRKASTG RNPRTGETMTIKASAQPKFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggatttgatcagcgctgttgccgaaagcagcggccttagcaagagcgac gccagcaaggccgtcgaaggcgtattcgattccatttccgccgcgctgaagaagggcgac gaagtccgcctggtcggcttcggcaccttctccgtttcgcagcgtaaggcttccaccggc cgcaatccgcggactggtgaaacgatgaccatcaaggcttcggctcagcccaagttcaag gcgggcaagggtctgaaggactcggtcaactga

DBGET integrated database retrieval system