Sphingobium sp. EP60837: EP837_00636 Help Entry EP837_00636       CDS       T04432                                  Symbol xseB Name (GenBank) Exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism sphb  Sphingobium sp. EP60837 Pathway sphb03430   Mismatch repair Brite KEGG Orthology (KO) [BR:sphb00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     EP837_00636 (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sphb03400]     EP837_00636 (xseB) Enzymes [BR:sphb01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      EP837_00636 (xseB) DNA repair and recombination proteins [BR:sphb03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      EP837_00636 (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S RPA_interact_N Motif Other DBs NCBI-ProteinID:  ANI77075 UniProt:  A0A173KUR9 LinkDB All DBs Position 1:complement(672182..672442) Genome browser AA seq 86 aa AA seqDB search MAEDSKTEQGDLSQLSFEDALRALESIVRRLESGDVPLDESISLYAQGEELRKRCLERLQ AAEARIQKLTIDPAGAVTGAQPFGAD NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggccgaggacagcaagactgagcagggcgatttgtcccaattgtcgtttgaggatgcg ctgcgcgcactcgagtcgatcgttcgcaggctggaaagcggcgatgttccgctcgatgaa tccatctcgctctatgcgcagggtgaggaattgcggaagcgctgtcttgaacggctgcag gcggcggaggcccgcattcagaagctgacgatcgatcccgccggcgctgtgactggcgca cagccgttcggcgccgattga

DBGET integrated database retrieval system