Sphingobium sp. EP60837: EP837_00789 Help Entry EP837_00789       CDS       T04432                                  Name (GenBank) ATP synthase epsilon chain   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sphb  Sphingobium sp. EP60837 Pathway sphb00190   Oxidative phosphorylation sphb01100   Metabolic pathways Module sphb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EP837_00789  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphb00194]     EP837_00789 Photosynthesis proteins [BR:sphb00194]  Photosystem and electron transport system   F-type ATPase [OT]    EP837_00789 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  ANI77226 UniProt:  A0A173KT97 LinkDB All DBs Position 1:821975..822229 Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGAIQIFASAGSAPE VIPVQGGFAEVNEKGLTVLAEHAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgacccccgaaaagctcgtccgctcggaagaggtctat caggtcgtcgtccccggcaccgatggcgacttcggcgtgctggaaggccacgcccccttc atgtccaccgtccgcgacggcgcgatccagatcttcgccagcgccggttcggcccccgaa gtcatccccgtccagggcggctttgcggaagtgaatgaaaagggcctaaccgtccttgcg gagcatgctggctga

DBGET integrated database retrieval system