Sphingobium sp. EP60837: EP837_03605
Help
Entry
EP837_03605 CDS
T04432
Name
(GenBank) Transducer protein Htr8
KO
K03406
methyl-accepting chemotaxis protein
Organism
sphb
Sphingobium sp. EP60837
Pathway
sphb02020
Two-component system
sphb02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
sphb00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
EP837_03605
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
EP837_03605
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02035 Bacterial motility proteins [BR:
sphb02035
]
EP837_03605
Bacterial motility proteins [BR:
sphb02035
]
Flagellar system
Chemotaxis proteins
MCPs
EP837_03605
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MCPsignal
CDC37_N
Hormone_1
Motif
Other DBs
NCBI-ProteinID:
ANI79989
LinkDB
All DBs
Position
2:complement(1033873..1035870)
Genome browser
AA seq
665 aa
AA seq
DB search
MPVTNCGDTKKDTLMALVKKAALGKRTRGKQVAAPQADEPQSGKTISIGSAPARSVRSKR
KPLTAVERIDQATQELSSGLGESASAAAELQRSVEQMASGADEAASAAQESLGLIGHLRS
HFREATNRAAASRNQTERLQAAFAETSAQIDASVAAIELNARRQLNSVAAIEQLEAAATR
ISIVGGMVEDLAEQTGMLALNASIEATRAGDGGRGFGIVADEVRELSEASEASATDIRKL
ATEIMEGVRTVASRMQAASARASEEALHGGGISTALGEARTTLAAVVDGTHEIAAAAVQA
EAAATESELGAEQVATAAEEQSAAAAEAQQAIEQQAASLEQSQQTAEALAELSAALGAGD
ADERAVEQVAAAAEQLSATVQELSGASSQIQIAIEQIARGAQLQSAATLEASSAMGQIET
SATIAKERAASAVERLDMIVASVADGSATLTKLISGVGEAVEETRAVLELLSALGETARR
AEKIADALALGALQTNMLGVSGAVEATRAGEAGQGFATVTADIRKLARSLAANAEDGKDV
VRAIQDSIHSARRDLDQIAAAGEVEAARNQGLLDRFAQMAAEVDATRADNGVILAGAEAI
QQAAREVKSGCEQIAQAAELAAEAAREAGVAAQQQAQGTEMLAAAVEDIASLAQALNIRS
DIAAE
NT seq
1998 nt
NT seq
+upstream
nt +downstream
nt
atgccggtgacaaattgcggcgatacaaagaaagatacgctcatggccctggtgaaaaag
gctgcgctgggaaagcgcacgcgcgggaagcaggttgcagcgccacaagcggatgagccg
cagtccggcaaaaccatctcaatcggcagcgctcccgcgcgttcagtgcgttccaagcgc
aagccgctgacggcggtcgagcggatcgaccaagcgacacaggaactgtcgagcgggtta
ggagaatccgcctccgcagcggccgaactgcagcgcagcgtcgagcagatggcgagcggt
gctgatgaagccgccagcgcggcgcaggaatcgctgggcctcatcgggcatctgcgctcc
cacttccgggaagcgaccaatcgggcagccgcatcgcgcaatcagaccgagcggctccag
gcggcctttgccgaaacctctgcccaaatcgatgcgtccgttgctgcgatcgagcttaac
gcgcgccgccagctgaattccgttgccgcgatcgagcagctggaagcggctgcgacgcgc
atcagcatcgtcgggggtatggtcgaagatctcgccgagcagaccgggatgctggctttg
aacgcgtcgatcgaagccacgcgcgcgggcgacggcggcaggggctttggcatcgtcgcc
gacgaggtgcgcgagctttcagaagcttcggaagcgagcgccaccgacattcgcaaactc
gccacggagatcatggagggcgtccgcacggtcgcgagcaggatgcaggcggccagtgcg
cgagcgagcgaagaggccctgcatggcggcgggatcagcactgcgctaggcgaagcgcgg
accacattggcagcggtggtggacggcacgcatgagatcgcggccgccgcggttcaggcc
gaggccgctgctactgagtccgagcttggcgcggaacaggtcgcaaccgctgcggaggaa
cagtcggcagcggcagcggaagcgcagcaagccatagagcagcaggccgcctctctcgag
cagagccagcagacggccgaagcgctggccgaattgagcgcagcactgggagcgggggac
gctgacgagcgcgcggtagagcaagttgctgcggccgccgaacaattgtccgccaccgtg
caggagctgtcgggcgcatccagccagatccagatcgcaatcgagcagattgctcgcggg
gcgcaactgcaaagcgctgccacgctggaggccagttcggccatgggccagatcgaaacc
agcgctaccatcgcgaaggaacgtgcggcgagcgcggtcgaacgtctcgatatgattgtg
gcctcagtagcagacggcagcgcaaccctgacgaagttgatcagtggcgtaggtgaagcg
gtcgaggaaactcgcgctgtcctcgaactgctgagtgcccttggagagacggcgcgccgt
gccgaaaaaatcgccgacgccttggccctcggagcattgcagaccaatatgctaggcgtt
agcggcgctgtcgaagccacccgcgcgggtgaggcgggccagggttttgcgacagtgacc
gccgacatccgcaaactcgcgcgcagccttgcggccaatgccgaggacgggaaggatgtg
gtgcgcgcaattcaggacagcatccattcggcccgccgcgaccttgatcagattgcggcg
gcaggtgaggtcgaggccgcgcgtaaccaggggctgctcgaccgctttgcacaaatggcg
gccgaggttgacgcaacccgcgccgacaatggcgtaatcctggcgggcgcagaagcgatc
cagcaggccgcgcgtgaggttaagagcgggtgcgagcagatcgctcaagcggccgagttg
gcagcggaagccgctcgtgaagccggagtagccgcccagcagcaggcgcagggcacggag
atgctcgccgccgccgtcgaggatatcgcctcgctcgctcaagcgctcaatatccgcagc
gacatagccgccgaatga
DBGET
integrated database retrieval system