KEGG   Sphingobium sp. EP60837: EP837_03605
Entry
EP837_03605       CDS       T04432                                 
Name
(GenBank) Transducer protein Htr8
  KO
K03406  methyl-accepting chemotaxis protein
Organism
sphb  Sphingobium sp. EP60837
Pathway
sphb02020  Two-component system
sphb02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sphb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EP837_03605
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    EP837_03605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:sphb02035]
    EP837_03605
Bacterial motility proteins [BR:sphb02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    EP837_03605
SSDB
Motif
Pfam: MCPsignal CDC37_N Hormone_1
Other DBs
NCBI-ProteinID: ANI79989
LinkDB
Position
2:complement(1033873..1035870)
AA seq 665 aa
MPVTNCGDTKKDTLMALVKKAALGKRTRGKQVAAPQADEPQSGKTISIGSAPARSVRSKR
KPLTAVERIDQATQELSSGLGESASAAAELQRSVEQMASGADEAASAAQESLGLIGHLRS
HFREATNRAAASRNQTERLQAAFAETSAQIDASVAAIELNARRQLNSVAAIEQLEAAATR
ISIVGGMVEDLAEQTGMLALNASIEATRAGDGGRGFGIVADEVRELSEASEASATDIRKL
ATEIMEGVRTVASRMQAASARASEEALHGGGISTALGEARTTLAAVVDGTHEIAAAAVQA
EAAATESELGAEQVATAAEEQSAAAAEAQQAIEQQAASLEQSQQTAEALAELSAALGAGD
ADERAVEQVAAAAEQLSATVQELSGASSQIQIAIEQIARGAQLQSAATLEASSAMGQIET
SATIAKERAASAVERLDMIVASVADGSATLTKLISGVGEAVEETRAVLELLSALGETARR
AEKIADALALGALQTNMLGVSGAVEATRAGEAGQGFATVTADIRKLARSLAANAEDGKDV
VRAIQDSIHSARRDLDQIAAAGEVEAARNQGLLDRFAQMAAEVDATRADNGVILAGAEAI
QQAAREVKSGCEQIAQAAELAAEAAREAGVAAQQQAQGTEMLAAAVEDIASLAQALNIRS
DIAAE
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgccggtgacaaattgcggcgatacaaagaaagatacgctcatggccctggtgaaaaag
gctgcgctgggaaagcgcacgcgcgggaagcaggttgcagcgccacaagcggatgagccg
cagtccggcaaaaccatctcaatcggcagcgctcccgcgcgttcagtgcgttccaagcgc
aagccgctgacggcggtcgagcggatcgaccaagcgacacaggaactgtcgagcgggtta
ggagaatccgcctccgcagcggccgaactgcagcgcagcgtcgagcagatggcgagcggt
gctgatgaagccgccagcgcggcgcaggaatcgctgggcctcatcgggcatctgcgctcc
cacttccgggaagcgaccaatcgggcagccgcatcgcgcaatcagaccgagcggctccag
gcggcctttgccgaaacctctgcccaaatcgatgcgtccgttgctgcgatcgagcttaac
gcgcgccgccagctgaattccgttgccgcgatcgagcagctggaagcggctgcgacgcgc
atcagcatcgtcgggggtatggtcgaagatctcgccgagcagaccgggatgctggctttg
aacgcgtcgatcgaagccacgcgcgcgggcgacggcggcaggggctttggcatcgtcgcc
gacgaggtgcgcgagctttcagaagcttcggaagcgagcgccaccgacattcgcaaactc
gccacggagatcatggagggcgtccgcacggtcgcgagcaggatgcaggcggccagtgcg
cgagcgagcgaagaggccctgcatggcggcgggatcagcactgcgctaggcgaagcgcgg
accacattggcagcggtggtggacggcacgcatgagatcgcggccgccgcggttcaggcc
gaggccgctgctactgagtccgagcttggcgcggaacaggtcgcaaccgctgcggaggaa
cagtcggcagcggcagcggaagcgcagcaagccatagagcagcaggccgcctctctcgag
cagagccagcagacggccgaagcgctggccgaattgagcgcagcactgggagcgggggac
gctgacgagcgcgcggtagagcaagttgctgcggccgccgaacaattgtccgccaccgtg
caggagctgtcgggcgcatccagccagatccagatcgcaatcgagcagattgctcgcggg
gcgcaactgcaaagcgctgccacgctggaggccagttcggccatgggccagatcgaaacc
agcgctaccatcgcgaaggaacgtgcggcgagcgcggtcgaacgtctcgatatgattgtg
gcctcagtagcagacggcagcgcaaccctgacgaagttgatcagtggcgtaggtgaagcg
gtcgaggaaactcgcgctgtcctcgaactgctgagtgcccttggagagacggcgcgccgt
gccgaaaaaatcgccgacgccttggccctcggagcattgcagaccaatatgctaggcgtt
agcggcgctgtcgaagccacccgcgcgggtgaggcgggccagggttttgcgacagtgacc
gccgacatccgcaaactcgcgcgcagccttgcggccaatgccgaggacgggaaggatgtg
gtgcgcgcaattcaggacagcatccattcggcccgccgcgaccttgatcagattgcggcg
gcaggtgaggtcgaggccgcgcgtaaccaggggctgctcgaccgctttgcacaaatggcg
gccgaggttgacgcaacccgcgccgacaatggcgtaatcctggcgggcgcagaagcgatc
cagcaggccgcgcgtgaggttaagagcgggtgcgagcagatcgctcaagcggccgagttg
gcagcggaagccgctcgtgaagccggagtagccgcccagcagcaggcgcagggcacggag
atgctcgccgccgccgtcgaggatatcgcctcgctcgctcaagcgctcaatatccgcagc
gacatagccgccgaatga

DBGET integrated database retrieval system