KEGG   Sphingomonas psychrotolerans: CVN68_00600
Entry
CVN68_00600       CDS       T05307                                 
Name
(GenBank) sensor histidine kinase
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
sphc  Sphingomonas psychrotolerans
Pathway
sphc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CVN68_00600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sphc01001]
    CVN68_00600
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sphc02022]
    CVN68_00600
Enzymes [BR:sphc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CVN68_00600
Protein kinases [BR:sphc01001]
 Histidine kinases
  OmpR family
   CVN68_00600
Two-component system [BR:sphc02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   CVN68_00600
SSDB
Motif
Pfam: DUF4118 HATPase_c HisKA HATPase_c_2
Other DBs
NCBI-ProteinID: ATY30673
UniProt: A0A2K8M9W6
LinkDB
Position
complement(137339..138862)
AA seq 507 aa
MDDADLRLPASQRRRSDGIHGHSRQSRRGTRRAGRIVTRIEQWAAFVRGLAALTAITAIT
GAATIEALRIGPAAAGLLYLLPVLWVSARAGLAAGLASAGFAAFCYNFFLLEPRYTLRIH
GLGDVAAFAVLTIVAIVTSRLASGLRAREMEAQERAEASAAEAEFAALLAKAHRHDTLDA
MALAFLAERYGDAQLIRGDDLAAKRTALAPLDAAAAAWALHNDGPSGHASEVMPSADFRF
VPLAPGGEDVLALAAGAHPRPRDGEVARAFARLWVQARDRLTAEAERRAREEADQRDAVR
RALLAALGHDFRTPLTVLKSGLAELDGDAPARLGLEVDRIIRLSEDLIATARIESGQPVR
LDPVDLVDIVAAATPRTAGVTLRTELPDDLPLVRADAVMLTHVLGNLIHNALRHARAEVV
IAARAAGEAVELAVCDDGSGIDPAVAATIFDRFISGGDREGGLGLGLAIARDLATAMGAS
LSAADAPGGGACFTVRLAIFPARGLPT
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggatgatgccgatctacgccttcctgcatcgcaacgccgccgatccgacgggattcat
gggcattcccgccaatcgcgtcgtggaactcggcgcgcaggtcgaattgtgacccgcatc
gagcaatgggccgcgttcgtgcggggcctcgcagccctcaccgccatcaccgcgatcacc
ggtgccgcgacgatcgaggcattgcggatcggccctgccgccgcgggtctgctctatctg
ctcccggtgctctgggtctcggcccgcgccgggctggccgcgggactggcgagcgccgga
ttcgccgccttctgctacaatttcttcctgctcgagccgcgctacaccctgcgcatccac
ggcctcggcgatgtcgcggccttcgcagtgctcaccatcgtcgcgattgtgaccagccgc
ctcgcctcgggcctccgcgcccgcgagatggaagcgcaggagcgcgccgaggcgagcgcc
gccgaagccgagttcgccgctttgctcgccaaggcgcatcgccacgacacgctcgatgcg
atggcgctcgccttcctcgccgaacgatatggcgatgcccagttgatccgtggggacgat
ctcgccgcgaagcgcaccgcgctcgccccgctcgatgcggcggccgcggcgtgggcgctt
cacaatgacggaccgagcgggcatgcgagcgaggtgatgccctccgccgactttcgcttc
gtgccgctcgcgccgggcggcgaagacgtgctcgcgctcgcagccggggcgcatccgcgg
ccgcgcgatggcgaggtcgcccgtgccttcgcccgtttatgggtgcaggcgcgcgaccgg
ctgaccgccgaggccgagcgtcgggcgcgcgaggaagccgatcagcgcgacgcggttcgt
cgggcgctgctcgccgcgctgggccatgatttccgcacgccgctcaccgtgctcaaatcg
gggctcgccgagctcgacggcgatgcgcccgcccggctcggcctcgaagtggatcgcatc
atccggctgagcgaagatctgatcgccaccgcccgcatcgaaagcgggcaaccggtgcgt
ctcgatccggtcgatctggtcgacatcgtcgccgccgccacgccccggacggcgggggtc
acgctcaggaccgaattgcccgacgatctgccgctggtccgcgccgacgcggtgatgctt
acccacgttctcggcaatctgatccacaatgcgctccgccacgcccgcgcagaggtggtg
atcgccgcccgcgccgccggcgaggcggtcgagctcgcggtgtgcgatgacggttcgggg
atcgaccccgccgtcgccgccactatcttcgatcgcttcatctcgggcggggatcgcgag
ggcggcctcggcctcggcctcgcgatcgcccgcgatctcgccaccgcgatgggggcgagc
ctgtcggctgccgatgcgccgggcgggggcgcctgcttcacggtgcggctcgcgatattc
ccggctcgggggcttcccacatga

DBGET integrated database retrieval system