Sphingomonas psychrotolerans: CVN68_05600 Help Entry CVN68_05600       CDS       T05307                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphc  Sphingomonas psychrotolerans Pathway sphc01100   Metabolic pathways sphc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CVN68_05600    00074 Mycolic acid biosynthesis     CVN68_05600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CVN68_05600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ATY31516 UniProt:  A0A2K8MG38 LinkDB All DBs Position complement(1238445..1238693) Genome browser AA seq 82 aa AA seqDB search MANQEEITQRVAALVVDHLGVDAGEVKPEASFIDDLGADSLDIVELVMAFEEEFGVEIPD DAAEKITTVGDAVSYISEHQED NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccaaccaggaagagatcacccagcgcgttgccgcgctcgtcgtcgaccatctcggc gtcgatgccggcgaagtgaagcccgaagcgagcttcatcgacgatctgggtgcggacagc ctcgacatcgtcgagctggtcatggctttcgaggaagaattcggcgtcgagattcccgat gacgcggccgagaagatcaccacggtcggcgacgcggtctcgtacatcagcgagcaccag gaagactga

DBGET integrated database retrieval system