Sphingomonas psychrotolerans: CVN68_15605 Help Entry CVN68_15605       CDS       T05307                                  Name (GenBank) molecular chaperone DnaJ   KO K09539   DnaJ homolog subfamily C member 19 Organism sphc  Sphingomonas psychrotolerans Brite KEGG Orthology (KO) [BR:sphc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sphc03110]     CVN68_15605    03029 Mitochondrial biogenesis [BR:sphc03029]     CVN68_15605 Chaperones and folding catalysts [BR:sphc03110]  Heat shock proteins   HSP40 / DNAJ    CVN68_15605 Mitochondrial biogenesis [BR:sphc03029]  Mitochondrial protein import machinery   Matrix    MMC/PAM proteins     CVN68_15605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DnaJ Motif Other DBs NCBI-ProteinID:  ATY33217 UniProt:  A0A2K8MH62 LinkDB All DBs Position 3429633..3429896 Genome browser AA seq 87 aa AA seqDB search MAKAILAALIIGAIYYLFFKPRPKPSAPKMPRDEARAILGVAADADEQAIRSAHRRLVSA VHPDKGGSEELTRRINAARDTLLRRSA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggccaaagcaatcctcgcggcgcttatcatcggcgcgatctattatttgttcttcaag ccgcggcccaagcccagcgcccccaaaatgccgcgggatgaagcccgtgcgatcctcggc gtcgccgccgatgcggacgagcaagcgattcgtagcgcacaccgccggctggtcagtgcg gtccatcccgacaagggcggatccgaggagttgacgcgacggatcaacgccgcgcgcgac acgttgcttcgccgtagcgcgtag

DBGET integrated database retrieval system