Rhizorhabdus wittichii DC-6: HY78_23545 Help Entry HY78_23545        CDS       T05200                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sphd  Rhizorhabdus wittichii DC-6 Pathway sphd00190   Oxidative phosphorylation sphd01100   Metabolic pathways Module sphd_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphd00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HY78_23545  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphd00194]     HY78_23545 Photosynthesis proteins [BR:sphd00194]  Photosystem and electron transport system   F-type ATPase [OT]    HY78_23545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  ARR56216 LinkDB All DBs Position complement(4990161..4990424) Genome browser AA seq 87 aa AA seqDB search MADLHFELVTPERLLRSEEVHMVVVPGSEGDFGVLAGHAPFMSTVRSGELAIYSSPTTVA ARIHVEGGFAEVNEKGLTVLAEQATEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcagacctgcatttcgaactcgtcaccccggaaaggctcctccgctcggaggaggtc catatggtggtggtccccggttccgagggcgacttcggcgtgctcgcgggccatgcgccc ttcatgtcgacggtccgctcgggcgagctggcgatctactcgagcccgaccacggttgcc gcgcgcatccatgtcgagggcggcttcgccgaggtcaacgagaagggcctgacggtgctg gcggagcaggcgaccgaagcctga

DBGET integrated database retrieval system