KEGG   Sphingomonas sp. FARSPH: DM480_05340
Entry
DM480_05340       CDS       T05685                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K05847  osmoprotectant transport system ATP-binding protein [EC:7.6.2.9]
Organism
sphf  Sphingomonas sp. FARSPH
Pathway
sphf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sphf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DM480_05340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphf02000]
    DM480_05340
Enzymes [BR:sphf01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     DM480_05340
Transporters [BR:sphf02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    DM480_05340
SSDB
Motif
Pfam: ABC_tran ABC_ATPase AAA_21 SMC_N AAA_29 AAA_22 AAA_16 AAA_25 nSTAND1 AAA_30 NACHT RsgA_GTPase SbcC_Walker_B FtsK_SpoIIIE NB-ARC AAA_28 DUF87 AAA_33 AAA_5 MMR_HSR1 AAA_18 AAA_15 G-alpha
Other DBs
NCBI-ProteinID: AXJ95017
LinkDB
Position
1098774..1099526
AA seq 250 aa
MPAESLCFDHVSKRFGDTSAVEDVCVDIPAGTFVALVGASGSGKSTLLQTINRLVEPDAG
RVLIDGVDVASGSAPALRRRIGYVFQGIGLFPHLSVAQNIAIGPRIAGQAAADVGALLDL
VALPRAVATRMPHALSGGQRQRVAIARALAPGAKLLLLDEAFGALDPVTRDALGQEIRGL
HDRLGLTTILVTHDMAEALLLADRVLVMHAGRIVADETPAALLHGAGGDAAQALVAVPRD
QASRLAALDA
NT seq 753 nt   +upstreamnt  +downstreamnt
atgccagcagaatcgctttgcttcgatcacgtttccaagcggttcggcgatacgtcggcg
gtcgaggacgtctgcgtcgatattcccgccggcacctttgtggcgctcgtcggcgcatcg
ggatcgggcaagtcgaccctgctgcagacgatcaaccggctggtcgaacccgatgcgggg
cgcgtgctgatcgacggtgtcgatgtcgccagcggttccgctcccgcgctgcgccgccgg
atcggctacgtctttcaggggatcggcctgttcccgcacctgagcgtcgcgcagaatatc
gcgatcggcccgcgcatcgccggccaggcggcggcggacgtcggcgcgttgctggatctc
gtcgctttgccccgcgccgtcgcgacgcggatgccccatgcgctgtcgggtggccagcgc
cagcgcgtcgcgatcgcccgcgcgctcgcgcccggcgcgaagctgctgctgctcgacgag
gcgttcggcgcgctcgaccccgtcacgcgcgatgcgctggggcaggagatacgcgggctg
cacgaccggctcggcctgacgacgatcctcgtcacgcacgacatggcggaggctttgttg
ctcgcggatcgcgtgctggtgatgcacgcggggcggatcgtcgccgacgagacgccggcc
gcgctgttgcatggcgcgggcggcgatgcggcgcaggcgctggtcgcggtgccgcgcgac
caggcgagtcggctggcggcgctcgacgcatga

DBGET integrated database retrieval system