Sphingomonas sp. FARSPH: DM480_10985 Help Entry DM480_10985       CDS       T05685                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphf  Sphingomonas sp. FARSPH Pathway sphf01100   Metabolic pathways sphf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM480_10985    00074 Mycolic acid biosynthesis     DM480_10985   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM480_10985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AXJ97031 UniProt:  A0A345WTM9 LinkDB All DBs Position complement(2301819..2302070) Genome browser AA seq 83 aa AA seqDB search MTDRTQILDTIKAQIEPFNKKGVALTEATTFQGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIENIGQLADAVAKLKADQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccgcactcagattctcgacacgatcaaggcgcagatcgaacccttcaacaag aagggcgtcgcgctgaccgaggccaccacctttcagggcgatctggaatgggacagcctg accgtgatggatttcgtcgctgcgatcgaggacgaattcgacatcatcatcacgatgaac atgcaggcggagatcgagaatatcggccagctcgccgatgcggtcgccaagctgaaggcc gatcaggcatga

DBGET integrated database retrieval system