Sphingomonas sp. FARSPH: DM480_15180 Help Entry DM480_15180       CDS       T05685                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphf  Sphingomonas sp. FARSPH Pathway sphf01100   Metabolic pathways sphf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM480_15180    00074 Mycolic acid biosynthesis     DM480_15180   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM480_15180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AXJ96628 UniProt:  A0A345WSH6 LinkDB All DBs Position complement(3209682..3209918) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDEHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gacaaggtgaccgaggacgcgagcttcatcgacgatctcggtgccgacagcctcgacatc gtcgagctcgtcatggcgttcgaggaagagttcggtgtcgagattccggacgacgccgcc gagaagatcacgaccgtcaaggacgcgatcacctacatcgacgagcacaaggcgtaa

DBGET integrated database retrieval system