Sphingorhabdus sp. M41: AZE99_01345
Help
Entry
AZE99_01345 CDS
T04317
Name
(GenBank) sodium-independent anion transporter
KO
K03321
sulfate permease, SulP family
Organism
sphg
Sphingorhabdus sp. M41
Brite
KEGG Orthology (KO) [BR:
sphg00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
sphg02000
]
AZE99_01345
Transporters [BR:
sphg02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
AZE99_01345
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
MFS_MOT1
STAS_2
Motif
Other DBs
NCBI-ProteinID:
AMO70674
LinkDB
All DBs
Position
complement(274358..276127)
Genome browser
AA seq
589 aa
AA seq
DB search
MKISRYLPILDWGSRYNSTTLTNDGVAAIIVTIMLIPQSLAYAMLAGLPPEIGLYASILP
LIAYAIFGTSRTLAVGPVAVVSLMTLTAASAVAPPGSAEFIAAALVLALLSGLFLLLLGI
FKLGFLANLLSHPVVSGFITASGIIIATSQLKSIFGIKASGAAMPELVSSIAATIGTTNM
PTLIIGVSATAFLFWVRKGLKPLLMRLGLPARPAELIAKAGPIAAVAVSTLATILFDLEA
QGVKVVGDIPQSLPPFSVPLIDMELWKTLAIPALLLSIIGFVESVSVGQTLAAKRRQRID
PDQELIGLGAANISAAFSGGYPVTGGFARSVVNFDAGAETPAAGAFTAVGIALAALFLTP
LLASLPIATLAATIIVAVLSLVDFKTPQTIWRYSKMDFAAMAATIIVTLLAGVEPGVIAG
VGLSLALFLWRSSRPHAAIVGRVPETEHFRNVNRHKVFTDPRILTIRIDESLTYLNARWL
EEFILEQVAEQKTVRHVILMCSAVNEIDASALESIEAINHRLEDGGISLHLSEVKGPVMD
RLDRSHFLDQLSGNVYLSQNGAYSALIAIADSEDKADSPVDIWSARGLI
NT seq
1770 nt
NT seq
+upstream
nt +downstream
nt
atgaaaatctcccgctatttgccgatcctcgattggggcagccgctataacagcaccaca
ttgaccaatgacggtgtggccgcgatcatcgtcacgatcatgctgatcccgcaaagcctg
gcttatgccatgctcgccggattgccgccggagatcgggctctacgcctcgatcctgccg
ctgattgcctatgcgatattcggcaccagccggaccctggcggtcggaccggttgcggtg
gtgtcgctgatgaccctgaccgccgccagcgccgtcgctcctcccggcagcgccgaattt
atcgcggccgctttggtactggcgctgctttcgggcctgttcctcctgcttctcggcata
ttcaagctcggctttctggccaatttgctgtcccatccggtggtgtccggattcatcacc
gccagcggcatcatcatcgccaccagccagctgaaatcgatattcggtatcaaggcgagc
ggggccgccatgcccgaactggtttccagcattgccgcgaccatcggtacaaccaatatg
ccgacgctgatcatcggcgtctctgcgaccgcctttctcttctgggtccgcaagggcctg
aagccattgctgatgcgtcttggccttccggcccgtccggccgaactgatcgccaaggcc
ggaccgattgccgccgtcgccgtttcgacccttgcgacgatcctgttcgatctcgaggcc
cagggggtcaaggtggtcggcgacatcccgcaaagcctgccgcccttctccgtgcccctg
atcgatatggagctctggaaaacgctagcgataccggcgttattgttgagcatcatcggt
tttgtcgaatccgtctctgtcggccagacactggcggccaagcggcgtcagcggatcgac
cccgatcaggaactgatcggcctcggtgcagccaatatctcggccgctttctcgggcggc
tatccggtcaccggcggatttgcccgttcggtggtgaatttcgatgccggcgccgagacg
cccgccgccggagccttcaccgcggtcgggatcgccttggcagcgctgtttctcaccccg
cttctcgcatcccttcccatcgccacgctcgccgcgaccatcatagtcgccgtgctgagc
ctggttgatttcaagaccccgcaaacgatctggcgctattcgaaaatggactttgccgcc
atggcggcgacaatcattgtcactcttctcgccggcgtcgagccgggcgtgatcgcgggt
gtcggcctgagcctcgcgctattcctgtggcgcagttcgcgaccccatgccgccatcgtc
ggccgggtccccgagaccgagcatttccgcaacgtcaatcgccacaaggttttcaccgac
cccagaatattaactatccgcatcgacgaaagcctgacctatctcaacgcgcgctggctg
gaagaattcatacttgagcaagtcgccgaacagaagaccgttcgccacgtcatattgatg
tgctcggcggtcaatgagatcgatgcctcggcgctggaaagtatcgaggcgatcaaccac
cggctcgaggacggcggcatttcgctgcatctgtccgaagtcaagggtccggtaatggac
cggctggatcgctcgcattttctcgaccaattgtcgggtaatgtctatctttcgcaaaat
ggagcctattctgcactaattgcaattgcggacagcgaagacaaagccgacagtccggtt
gatatttggagcgcaagaggcctgatatga
DBGET
integrated database retrieval system