Sphingorhabdus sp. M41: AZE99_07195 Help Entry AZE99_07195       CDS       T04317                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphg  Sphingorhabdus sp. M41 Pathway sphg01100   Metabolic pathways sphg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AZE99_07195    00074 Mycolic acid biosynthesis     AZE99_07195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AZE99_07195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  AMO71665 UniProt:  A0A127MES2 LinkDB All DBs Position 1506277..1506513 Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEEAAFIDDLGADSLDIVELVMAFEEEFSVEIPDDAA EKIGTVKDAIDFIDKNKS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgagactgcagaccgcgtaaaaaagatcgttgttgagcatctgggtgttgaagcc gacaaagtgactgaagaagctgctttcatcgatgatctgggcgctgacagcctcgacatc gttgagctggttatggcgtttgaagaagaattcagcgtcgaaattccagatgatgcagcc gaaaaaatcggtaccgtcaaagacgccatcgattttatcgacaaaaacaagagttaa

DBGET integrated database retrieval system