Sphingorhabdus sp. M41: AZE99_07910 Help Entry AZE99_07910       CDS       T04317                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sphg  Sphingorhabdus sp. M41 Pathway sphg01100   Metabolic pathways sphg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AZE99_07910    00074 Mycolic acid biosynthesis     AZE99_07910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AZE99_07910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AMO71788 UniProt:  A0A127MF62 LinkDB All DBs Position complement(1656712..1656960) Genome browser AA seq 82 aa AA seqDB search MTREEVKRVFAEELESIAPEVDLSTVTDSTNIQEYFDLDSMDIYNLLAALHQRLDVDIPD KDASELLTVKTAVDYLLPALRT NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgaggaagtaaaaagggtatttgccgaagaactggaatccattgctcccgaa gtcgatctgtcgaccgtgactgatagcaccaatattcaggaatatttcgatctggattcg atggatatctataatcttctggcggcgcttcaccaaagactggatgtcgacattcccgac aaggatgcatcggaactgctgacggtcaaaactgccgtggattatctgcttcccgcactt cggacttaa

DBGET integrated database retrieval system