Sphingorhabdus sp. M41: AZE99_10100 Help Entry AZE99_10100       CDS       T04317                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism sphg  Sphingorhabdus sp. M41 Pathway sphg02020   Two-component system sphg02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sphg00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AZE99_10100  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     AZE99_10100  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sphg02035]     AZE99_10100 Bacterial motility proteins [BR:sphg02035]  Flagellar system   Flagellar assembly proteins    Others     AZE99_10100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Melittin Motif Other DBs NCBI-ProteinID:  AMO72154 UniProt:  A0A127MFW7 LinkDB All DBs Position complement(2118777..2119019) Genome browser AA seq 80 aa AA seqDB search MGLKEAAAKSGVAAASVEKSTAPDGNPAVPKILTTGRPAFDAKKVADIRLQFLSGDYHVD TDALAVKILNAAVLEVHSTY NT seq 243 nt NT seq  +upstreamnt  +downstreamnt ttgggtttgaaggaggctgctgccaaaagcggtgttgccgccgcgagtgtcgagaaatcg acggcgccagacgggaacccggcagttccgaaaattctgacgaccggaagacctgcgttt gatgcgaagaaggtggcggatataagactgcaatttctgtccggtgactaccatgtcgat accgacgcgctagcggttaagattcttaatgcagcggttcttgaagtgcattcgacatat tga

DBGET integrated database retrieval system