Sphingomonas hengshuiensis: TS85_05920 Help Entry TS85_05920        CDS       T03848                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphi  Sphingomonas hengshuiensis Pathway sphi01100   Metabolic pathways sphi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TS85_05920    00074 Mycolic acid biosynthesis     TS85_05920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TS85_05920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AJP71407 UniProt:  A0A7U4J772 LinkDB All DBs Position 1354414..1354650 Genome browser AA seq 78 aa AA seqDB search MSEIESKVVSLVVDHLGVDQKDVTLEASFIDDLGADSLDIVELVMAFEEEFGVEIPDEAA EKIGTVRDAVDYITANKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagagattgagagcaaggtcgtgtcgctggtcgtcgaccacctcggcgtcgaccag aaggacgtcacgctggaggcgagcttcatcgacgacctcggcgcggacagcctcgacatc gtcgagctggtcatggcgttcgaggaagaattcggcgtcgagatccccgacgaagccgcg gaaaagatcgggacggtccgcgacgccgtcgactatatcacggccaacaaggcctga

DBGET integrated database retrieval system