Tardibacter chloracetimidivorans: BSL82_06185 Help Entry BSL82_06185       CDS       T04967                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism sphj  Tardibacter chloracetimidivorans Pathway sphj02024   Quorum sensing sphj03018   RNA degradation Brite KEGG Orthology (KO) [BR:sphj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BSL82_06185  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BSL82_06185  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sphj03019]     BSL82_06185    03036 Chromosome and associated proteins [BR:sphj03036]     BSL82_06185 Messenger RNA biogenesis [BR:sphj03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BSL82_06185 Chromosome and associated proteins [BR:sphj03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BSL82_06185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  API58950 UniProt:  A0A1L3ZTN0 LinkDB All DBs Position complement(1192037..1192282) Genome browser AA seq 81 aa AA seqDB search MADKSNNLQDIFLNTLRKTKTPVTMFLVNGVKLQGVITWFDNFSVLLRRDGHSQLVYKHA ISTVMPASPINLAEIDSKADD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccgacaagtccaacaaccttcaggacatttttctcaacactctccgcaagacgaag acgccggtgaccatgttcctggtcaatggagtgaagctccagggcgtgatcacctggttc gacaacttctcggtgctgctccgccgcgatggacattcgcagcttgtctacaagcatgcg atctccaccgtaatgccggcaagcccgatcaaccttgcggagatcgacagcaaggctgac gattga

DBGET integrated database retrieval system