KEGG   Tardibacter chloracetimidivorans: BSL82_06200
Entry
BSL82_06200       CDS       T04967                                 
Name
(GenBank) nitrogen regulation protein NR(I)
  KO
K07712  two-component system, NtrC family, nitrogen regulation response regulator GlnG
Organism
sphj  Tardibacter chloracetimidivorans
Pathway
sphj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSL82_06200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sphj02022]
    BSL82_06200
Two-component system [BR:sphj02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   BSL82_06200
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 Response_reg HTH_8 AAA_5 AAA_2 AAA_16 AAA Mg_chelatase FleQ UPF0175 HTH_30 Phage_NinH
Other DBs
NCBI-ProteinID: API58952
UniProt: A0A1L3ZTI3
LinkDB
Position
complement(1196115..1197560)
AA seq 481 aa
MSPGKILVVDDDAAIRTVVSEALKQAGHEVRAVPDLASMRLALAEGYGEVLVTDVMLPDG
NGLDVVPEIISSYPNLPVIVLSAQNTLATAVRATERGAFEYLPKPFDLDELARAVQDALV
LSRKEESSTEGDDHHEPLPLIGRSAAMQEVYRTIARVVPNDLTVLVLGESGTGKELVARA
IHDLGPRSKKSFVAINMAAIPRELIESELFGHERGAFTGAQARTSGRFEQAQGGTLFLDE
IGDMPMDAQTRLLRVLQSGEFTTVGGARAIRADVRIIAATNKDLRKLVEAGQFREDLFYR
LNVVPVRIPPLRARADDIAELARYFLDQAAALGLPRKTLNPDAVNRLMAHPWPGNVRELE
NLMRRLAALSREEAITAGAVEQGLLEGVENKESLGQTAGSLGEAMELYLARLFAAYDRSL
PPDGLYERVLAEIEPPLLLLSLAAARGNQVRAARLLGMNRNTLRKKLAERGIDAPTVRRM
G
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgagccccggcaagattctggtcgtcgatgatgacgcggcgatccgcaccgtggtgagc
gaggcgttgaagcaggcggggcatgaggtgagggccgtgccggaccttgcttcgatgcgt
ctcgcccttgccgaaggctatggtgaggtgcttgtcaccgacgtcatgctgcccgacggc
aacggccttgacgtggtgccggagatcatcagcagctatccgaacctcccggtcatcgtg
ctgtcggcccagaacacgcttgcaacggcggtgcgcgcgaccgagcggggggcattcgaa
tatctgccgaagccgttcgatctggatgagttggcgcgcgccgttcaggacgcgctcgtc
ctctcccgcaaggaagagagctcgacggagggcgacgaccatcacgagccattgccgctg
atcggcaggtcggccgcaatgcaggaggtctatcgcacgatcgcgcgcgtcgtgccgaac
gacctcaccgtgctggtcctgggagaatccggcaccggcaaggaactggtggcccgcgcc
attcacgatctcggcccgcgcagcaagaagtccttcgtcgccatcaacatggcggccatt
ccgcgcgagctgatcgaatccgagctgttcgggcatgaacggggcgcgttcaccggggcg
caggcgcgcacatccggccggtttgaacaggcgcagggcggcacgctgttcctggatgaa
atcggcgacatgcccatggatgcgcagacgcggctgctgcgcgtcctgcaatctggagag
ttcaccaccgtgggcggcgcgcgcgcgatccgcgccgacgtccgcatcatcgccgcgacc
aacaaggatctgcgcaagctggtggaggcagggcagttccgcgaggatctgttctatcgc
ctgaacgtcgtgccggtccggattccgccgctcagggcccgcgcggacgacattgccgag
cttgcgcgctatttcctggatcaggcggcggcgctcggcctgccccgcaagaccctgaac
cccgatgccgtcaaccggctgatggcgcacccctggccgggcaatgtccgggaactcgaa
aatctgatgcgtcgccttgccgccctcagccgcgaggaggcgataaccgccggcgccgtg
gagcaagggctgctggaaggcgttgagaacaaggagagtctggggcagacggccggctcg
ctcggcgaggccatggagctttatcttgcgcggctgttcgccgcctatgaccggtcgctt
cccccggacggcctttatgagcgcgtgctggcggagatcgagccgccgctgctgttgctg
agtctggccgccgcgcgcgggaatcaggtccgcgccgcccggctgttggggatgaaccgc
aacaccttgcgcaagaagctggccgaacgcggcatcgacgcgccaaccgtccgtcgcatg
ggatag

DBGET integrated database retrieval system