KEGG   Tardibacter chloracetimidivorans: BSL82_17595
Entry
BSL82_17595       CDS       T04967                                 
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
sphj  Tardibacter chloracetimidivorans
Pathway
sphj00361  Chlorocyclohexane and chlorobenzene degradation
sphj01100  Metabolic pathways
sphj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sphj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    BSL82_17595
Enzymes [BR:sphj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     BSL82_17595
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg Big_1
Other DBs
NCBI-ProteinID: API61265
UniProt: A0A1L4A070
LinkDB
Position
pHSL1:complement(5967..6740)
AA seq 257 aa
MSNNRIDAVVSDIVNGIRQALIKHEVTFDEYRAGVMYAVKTGEAGEIPLLLDVFLNSTIS
DIENAAYGGTEGTIEGPYYLPDAPLISNGGEILTYDDDRNVPMIVRGTVKDLQGRPIAGA
TVDIWHSTPDGYYGGIHNDIPANYYRGKVLTDSEGRYFVRSTVPVPYKIPDQGPTGALLE
MMGGHSWRPAHVHFKVRADGYHTLTTQSYFEQGDYVDDDCCNGVRQVQIKPDVRENGEKV
IENDFQLAPDVIASRAA
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagcaacaatcgtattgatgccgtggtgtctgacatcgtgaacggaattcgtcaggcg
cttatcaagcatgaagtgacgttcgacgaatatcgggccggcgtcatgtatgccgtgaaa
acgggcgaggcgggcgagattccgcttttgctcgacgtcttcctgaactcgaccatcagc
gacatcgagaatgccgcttacggcggcacggaggggactatcgaaggcccctattatctg
ccggacgcgcccctcatttcgaacggcggcgagattcttacctatgacgacgatcgcaac
gtcccgatgatcgtgcgcggcacggttaaggatctccaaggcaggcccatcgccggcgct
accgtcgacatctggcattcgacgccggacggctattatggcggcatccacaacgacatc
ccggcaaactattatcgcggcaaggttctgaccgactccgaaggtcgatacttcgtccgt
tcgaccgtgcccgtcccctacaagattcccgaccaggggccgaccggcgcgctactggag
atgatggggggacatagctggcgcccggcgcacgttcacttcaaggtccgcgcggacggc
tatcatacgctcaccacgcagagctatttcgagcagggcgactatgttgacgacgattgc
tgcaatggcgttcgtcaggtccagatcaagcccgatgtgcgggaaaatggcgagaaggtg
atcgagaacgacttccaactcgcacctgacgtcatcgcgtcgcgcgcggcctga

DBGET integrated database retrieval system