Sphingopyxis fribergensis: SKP52_05540 Help Entry SKP52_05540       CDS       T03542                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sphk  Sphingopyxis fribergensis Pathway sphk01100   Metabolic pathways sphk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SKP52_05540    00074 Mycolic acid biosynthesis     SKP52_05540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SKP52_05540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AJA08034 UniProt:  A0A0A7PDJ5 LinkDB All DBs Position 1153728..1153964 Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaaaaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtgaccgaggaagcaagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactggtgatggcgttcgaagaagaattcggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcaaggacgcgatcgactatatcgaagcgaacaagggctga

DBGET integrated database retrieval system