Sphingopyxis fribergensis: SKP52_12390 Help Entry SKP52_12390       CDS       T03542                                  Name (GenBank) preprotein translocase subunit   KO K03210   preprotein translocase subunit YajC Organism sphk  Sphingopyxis fribergensis Pathway sphk02024   Quorum sensing sphk03060   Protein export sphk03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sphk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SKP52_12390  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SKP52_12390  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SKP52_12390  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sphk02044]     SKP52_12390 Secretion system [BR:sphk02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    SKP52_12390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC MreC DUF2615 T2SSM Motif Other DBs NCBI-ProteinID:  AJA09370 UniProt:  A0A0A7PH94 LinkDB All DBs Position complement(2642042..2642371) Genome browser AA seq 109 aa AA seqDB search MSTQLLLTQAAGSGGGAAGFLMLVPYLLIFAVFWFFLIRPQQVRAKEHRNKVAAVKPRDQ VVTGGGIVGKVTRVDDEFVDVEIAQGVKIKVVKSTLADVLQPGGKPAND NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgcaattgcttctgacccaggcggccggatcgggcggcggggctgccggtttc ctgatgctggttccctatctgctgatttttgcggtgttctggttcttcctgatccgcccg cagcaggttcgcgcaaaggaacatcgcaacaaggtcgcggcggtcaagccgcgcgaccag gtcgtgaccggcggcggtatcgtcggtaaggtcacgcgcgtcgacgatgagttcgtcgat gtcgaaatcgcgcagggggtgaagatcaaggtcgtcaagtcgactctcgccgacgtcctg cagcccggtggcaagcccgccaacgactga

DBGET integrated database retrieval system