Sphingopyxis fribergensis: SKP52_18540 Help Entry SKP52_18540       CDS       T03542                                  Name (GenBank) hypothetical protein   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sphk  Sphingopyxis fribergensis Pathway sphk00190   Oxidative phosphorylation sphk01100   Metabolic pathways Module sphk_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sphk00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SKP52_18540  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sphk00194]     SKP52_18540 Photosynthesis proteins [BR:sphk00194]  Photosystem and electron transport system   F-type ATPase [OT]    SKP52_18540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  AJA10578 UniProt:  A0A0A7PMZ7 LinkDB All DBs Position 3927079..3927336 Genome browser AA seq 85 aa AA seqDB search MALKFELVTPARLERSIDVHMVTVPGSEGDFSVLEGHAPFMATLRNGPLTIYATAGAAPE VIEVEGGFAEVNEAGLTVLAEHIAS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccctgaagttcgaactcgtcacccccgcccgcctcgagcggtcgatcgacgtccat atggtcaccgtacctggcagcgaaggtgatttttcggtgctcgaaggccatgcgccgttc atggcgacgctgcgcaacgggccgctgaccatctatgcgaccgcgggcgccgcgcccgag gtgatcgaggtcgagggcggctttgccgaggtgaacgaggccggcctgaccgttctggcc gagcatatcgcaagctga

DBGET integrated database retrieval system