Sphingopyxis fribergensis: SKP52_23195 Help Entry SKP52_23195       CDS       T03542                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism sphk  Sphingopyxis fribergensis Brite KEGG Orthology (KO) [BR:sphk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sphk03032]     SKP52_23195    03036 Chromosome and associated proteins [BR:sphk03036]     SKP52_23195    03400 DNA repair and recombination proteins [BR:sphk03400]     SKP52_23195 DNA replication proteins [BR:sphk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SKP52_23195 Chromosome and associated proteins [BR:sphk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SKP52_23195 DNA repair and recombination proteins [BR:sphk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SKP52_23195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 Peptidase_C23 Motif Other DBs NCBI-ProteinID:  AJA11481 UniProt:  A0A0A7PN00 LinkDB All DBs Position 4884849..4885124 Genome browser AA seq 91 aa AA seqDB search MNHAELSDSVATALGLSKADAKKAVDAVFAAITDAAAKGDEVSVNGFGKFKVKESAAREG RNPSTGETIQIAASKKLTFGAAKAVKDRLNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaccacgccgaactgtcggacagcgtcgcaaccgcacttggtctgagcaaggccgat gcgaagaaggctgtcgatgccgttttcgctgcgatcaccgacgccgccgccaagggcgac gaagtctcggtgaacggcttcggcaagttcaaggtcaaggaatcggccgcgcgtgaaggc cgcaatccctcgactggcgaaaccatccagattgcggcttcgaagaagctgaccttcggc gccgcgaaggccgtcaaggatcgtctgaacggctga

DBGET integrated database retrieval system