Sphingorhabdus lutea: LPB140_06155 Help Entry LPB140_06155      CDS       T04602                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphl  Sphingorhabdus lutea Pathway sphl01100   Metabolic pathways sphl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LPB140_06155    00074 Mycolic acid biosynthesis     LPB140_06155   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LPB140_06155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  APG62442 UniProt:  A0A1L3JBD8 LinkDB All DBs Position 1305388..1305621 Genome browser AA seq 77 aa AA seqDB search MSDTAERVQKIVVEHLGVEADKVNPEASFIDDLGADSLDIVELVMAFEEEFNVEIPDEAA QDIATVKDAIDFIEKQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagcagaacgggtacaaaaaattgttgtcgaacatttgggcgtcgaagcc gataaggtaaatccagaagcaagctttatcgatgatcttggcgcggatagccttgacatt gttgaattggttatggcttttgaagaagaatttaacgtagaaattcctgatgaagctgca caagatattgcaaccgttaaggacgcaatcgactttattgaaaagcaggcttaa

DBGET integrated database retrieval system