Sphingorhabdus lutea: LPB140_06195 Help Entry LPB140_06195      CDS       T04602                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sphl  Sphingorhabdus lutea Pathway sphl01100   Metabolic pathways sphl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LPB140_06195    00074 Mycolic acid biosynthesis     LPB140_06195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LPB140_06195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APG63648 UniProt:  A0A1L3JES6 LinkDB All DBs Position complement(1311013..1311276) Genome browser AA seq 87 aa AA seqDB search MSDDLITKVKEILRDALGLSDHQIDEMDLSTELFGALPELDSMAIATLLTEMEDRLDIIV DDEDVDGELFATLGSLVTYARIKTKGK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgatctgattaccaaggtaaaggaaattttgcgcgatgcgcttggcctttcc gatcatcaaattgatgagatggatttatccaccgaattatttggcgcactgcccgaactt gattccatggccattgcgaccttgttaaccgagatggaagaccggttggatatcattgtc gatgatgaggatgtcgacggcgaattattcgccacattgggcagtttagttacctatgcg cggattaaaaccaaaggtaaatga

DBGET integrated database retrieval system