KEGG   Sphingomonas sp. MM-1: G432_02115
Entry
G432_02115        CDS       T02498                                 
Name
(GenBank) GcrA cell cycle regulator
  KO
K13583  GcrA cell cycle regulator
Organism
sphm  Sphingomonas sp. MM-1
SSDB
Motif
Pfam: GcrA HTH_7 HTH_23
Other DBs
NCBI-ProteinID: AGH48151
LinkDB
Position
454004..454693
AA seq 229 aa
MAWTDERIDQLKRLWEAGNTASQIAEELGGVSRNAVIGKAHRLGLQSRPSPVRGGDSSAA
DAAPKAAAPKAEPAAAAPPPPPPAAQPAPPPVAKAAPPAPAPTPAPTAAAPAAPAAPQTV
FRSIGPGGFQRQSPGEQQAPSTPAPPRRLVPAKPSAEVAGKTSLLDLNDKICKWPIGHPG
EPDFHFCGEPINPGFPYCLDHCSVAYQAQLPRRDRRPPPPMPYGGPRVR
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcctggacggacgaacggatcgatcagctgaagcgcctctgggaggcgggcaacacc
gcgagccagatcgccgaggaactgggcggggtcagccgcaatgcggtgatcggcaaagcc
catcgcctcggcctgcaatcgcgcccgtcgccggtgcgcggcggggattccagcgcggcc
gatgccgcgcccaaggccgccgcgccgaaggccgagcctgcggcggccgcgcctccgcct
ccgcctccggcggcgcagccggctcccccgccggtcgccaaggccgctccgcccgctccg
gcacccacgccggcgcccacagccgccgcgcctgccgctccggccgccccgcagacggtg
ttccgctcgatcggtccgggcggcttccagcgccagtcccccggcgagcagcaggccccc
tccacgcccgccccgccccgccggctggtgcctgccaagccttcggccgaggttgccggc
aagacgagcctgctcgacctcaacgacaagatctgcaaatggccgatcggccatccgggc
gagccggatttccatttctgcggtgagccgatcaatccgggcttcccttattgcctggat
cattgctcggtggcctatcaggcgcagcttccgcgccgcgatcgccgtccgccgccgccc
atgccctatggcggcccgcgcgtccgctaa

DBGET integrated database retrieval system