KEGG   Sphingomonas sp. MM-1: G432_15535
Entry
G432_15535        CDS       T02498                                 
Name
(GenBank) 4-phytase
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm01501  beta-Lactam resistance
sphm02010  ABC transporters
sphm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sphm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G432_15535
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G432_15535
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    G432_15535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphm02000]
    G432_15535
Transporters [BR:sphm02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    G432_15535
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-ProteinID: AGH50825
LinkDB
Position
complement(3269730..3271292)
AA seq 520 aa
MSDRCGRLAWRFAAVALLALPLACGSPRKAGTPPPADTIVRLSDTEAKSVDPHKASELSS
VRVAADLFEGLTRFDAAGQPEPGLATGWTTSADGLVWRFPLRPGLRFSDGEPITPATFAA
VHARLVDPRTASPNAPLFAAIADVAGEGRTVVIRLRHPFAALPALLAHPAMAALPVHRIA
ALGDGWTAERPLVTSGAYRMTAWTLNDAMRLEANPAWHDAPPPIRAVEWRPVPDRLTALR
MFRAGAADTTADFPSTRLDWIRRELPGAAHVAPYNGSYYFAFNLRHPPFDDIRVRRALNL
AVDRRWIAGPLMAIGTPPAWGVVPAGIDGLPAYHPAWADWPKERRLAAAAALLAEAGYGP
RRPLVFDIRFNSDADHRRVAIALAAMWRPLGVEARLLNSEATLHFSAMRRGDFTLARSGW
IADLAAPENFLAVHRSDAGPINYSGYANPRYDAAYDAAIAEPDPARRARAMRAAEAVLMA
DAPVLPIYFYVSRALVAPRVTGWRDNPANVHPTRTLGLKR
NT seq 1563 nt   +upstreamnt  +downstreamnt
ttgtctgatcggtgcggccggctggcctggaggttcgcggccgtggcgctgctggccctg
ccgctggcctgcggatccccgcgcaaggcgggcacgccgcccccggccgacaccatcgtc
cgcctttccgataccgaggcgaaaagcgtcgatccgcacaaggcgtccgaactgtcctcg
gtccgcgtcgccgccgatctgttcgaagggctcacccgattcgatgccgcgggccagccc
gaacccggcctcgccaccggctggacgacatcggcggacggcctggtctggcgcttcccg
ctgcgccccggcctgcgtttctccgacggggagccgatcacgcccgccaccttcgcggcc
gtccacgcccgcctcgtcgatccgcgcacggcatcgcccaacgccccgctcttcgccgcc
atcgccgatgtcgcgggcgaagggcgcacggtcgtcatccgcctgcgccacccgttcgcc
gcgctgcccgccctgctcgcccatcccgccatggcggcgctgcccgtgcatcgcatcgcg
gcgctgggcgatggctggacggcggaacggccgctcgtcacctccggcgcctatcggatg
acggcgtggacgctcaacgatgcgatgcggctggaagccaatcccgcctggcatgatgcc
ccgccaccgatccgcgcggtcgaatggcgccccgtgcccgatcggctcaccgcgctccgc
atgttccgggccggcgcggccgataccaccgccgatttcccctccacccggctggactgg
attcgccgcgagctgccgggcgccgcccatgtcgccccctataacggcagctattatttc
gccttcaacctccgccacccgcccttcgacgacatccgcgtccgccgcgcgctcaacctc
gcggtcgatcgccgctggatcgccggccccctgatggcgatcggcacgccgccggcctgg
ggcgtcgtgcccgccgggatcgatggcctgcccgcttatcatccggcctgggcggactgg
ccgaaggaacggcgcctggccgccgcggccgcgcttctggccgaagccggctatggcccg
cgccgcccgctggtcttcgacatccgcttcaacagcgatgccgatcatcgccgcgtcgcc
atcgcgctcgccgcgatgtggcgcccgctgggggtggaggcgcggctgctcaacagcgag
gcgacgctccatttctcggcgatgcggcgcggcgatttcaccctcgcccgctcgggctgg
atcgccgatctcgccgcgcccgagaattttctggccgtccatcgatccgatgccgggccg
atcaactattccggctatgccaatccgcgctacgatgccgcttatgacgccgccatcgcc
gaacccgatcccgcccgccgcgcccgcgcgatgcgggcggccgaggccgtgttgatggcg
gacgcgccggtgctgccgatctatttctatgtcagccgcgcgctggtggcgccgcgcgtc
accggctggcgggacaatccggccaatgtgcatcccacccgcacgctggggctgaagcga
tga

DBGET integrated database retrieval system