Sphingopyxis sp. MG: C3E99_00155 Help Entry C3E99_00155       CDS       T05382                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism spho  Sphingopyxis sp. MG Brite KEGG Orthology (KO) [BR:spho00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:spho03036]     C3E99_00155    03400 DNA repair and recombination proteins [BR:spho03400]     C3E99_00155 Chromosome and associated proteins [BR:spho03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     C3E99_00155 DNA repair and recombination proteins [BR:spho03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       C3E99_00155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Spectrin_7 Motif Other DBs NCBI-ProteinID:  AVA12461 LinkDB All DBs Position 26045..26233 Genome browser AA seq 62 aa AA seqDB search MATLAELLKQKEDLDKQIAAAQTAERAGVIKDIVAKCKEHGIKFADLKPHMTRPRKKKGE AA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggcaacccttgcggaactgcttaagcagaaggaagatttggataagcagattgcggct gcacagacggcagagcgtgcaggtgtgatcaaggatatcgtagcgaagtgcaaagagcac ggcattaaatttgctgatctcaaaccacatatgacaagaccacgcaaaaagaagggcgaa gctgcataa

DBGET integrated database retrieval system