Sphingopyxis sp. 113P3: LH20_03655 Help Entry LH20_03655        CDS       T04069                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism sphp  Sphingopyxis sp. 113P3 Brite KEGG Orthology (KO) [BR:sphp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sphp03110]     LH20_03655 Chaperones and folding catalysts [BR:sphp03110]  Protein folding catalysts   Protein disulfide isomerase    LH20_03655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 DSBA Thioredoxin_3 Glrx-like Thioredoxin_4 GST_N SH3BGR Motif Other DBs NCBI-ProteinID:  ALC11042 UniProt:  A0A0M4CZM5 LinkDB All DBs Position 779210..779470 Genome browser AA seq 86 aa AA seqDB search MATIEVYTKFLCPYCTRAKALLEKKGAEYREIDVSMDRAGLDAMIERAGGRRTVPQIFID GRHIGGSDDLAALDARGELDPLLGLG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcgacaatcgaagtctatacgaaatttctctgcccctactgcacgcgcgcgaaagcg ctgctcgagaagaagggggcagagtatcgcgagatcgacgtgtcgatggatcgcgctggc cttgacgcgatgatcgagcgcgccggtggccgccggacggtgccgcaaatcttcatcgac gggcgtcacatcgggggaagcgacgatctcgctgcgctcgatgcgcgcggcgagctggat ccgctcctggggcttggctga

DBGET integrated database retrieval system