Sphingopyxis sp. 113P3: LH20_03840 Help Entry LH20_03840        CDS       T04069                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism sphp  Sphingopyxis sp. 113P3 Pathway sphp00260   Glycine, serine and threonine metabolism sphp01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:sphp00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     LH20_03840 Enzymes [BR:sphp01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      LH20_03840     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      LH20_03840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev Motif Other DBs NCBI-ProteinID:  ALC11077 UniProt:  A0A0M4CQB6 LinkDB All DBs Position 810611..810898 Genome browser AA seq 95 aa AA seqDB search MLLIQCPFCGPRPEIEFRYGSEAHISRPDDPSALDDNEWRAFLYEKSNPAGEHAERWQHV HGCRRYFNAIRNTVTDEFLTSYPAGSPRPTKGEGE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcttctgattcaatgccccttttgcggacctcgtcccgaaattgaatttcgctacggt agcgaagcccatatcagccggccggacgatcccagtgcgctcgacgataatgaatggcgc gcgtttctctacgagaaaagcaatccagccggcgaacatgccgagcggtggcagcatgtc cacggttgcaggcgctacttcaacgccatccgcaacacggtaaccgacgaattcctgacg agctatcctgccggatcgcctcgcccaaccaaaggggaaggcgaatga

DBGET integrated database retrieval system