KEGG   Sphingopyxis sp. 113P3: LH20_15255
Entry
LH20_15255        CDS       T04069                                 
Name
(GenBank) sulfate permease
  KO
K03321  sulfate permease, SulP family
Organism
sphp  Sphingopyxis sp. 113P3
Brite
KEGG Orthology (KO) [BR:sphp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sphp02000]
    LH20_15255
Transporters [BR:sphp02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   LH20_15255
SSDB
Motif
Pfam: Sulfate_transp MFS_MOT1
Other DBs
NCBI-ProteinID: ALC13313
LinkDB
Position
complement(3085307..3086569)
AA seq 420 aa
MRRPKLLDTMRDYSWQLFRADALAGISVALVALPLCIAIAIASGSTPFVGLVTAIIGGFV
ISLTSGSRVQIGGPTGAFIVVVYGVIQDHGMDGLIVATIMAGLILILAGYFRAGRLIALI
PEAVINGFTIGIAAIIAASQLADAMGLSAGKVPADMIPKIEALWAARASFSGIAFAVTAV
TIAAILLLRRWRPRWPVLVIAVGAASLAVLSLNLPVDTVGSRFGALPSGLPAPHWPQVTL
ERLAELLPSALTIAFLAGVESLLSAIVADRMFGGQHRPSAELLAQGYANVLTPLFGGLPV
TGAIARTATNVRAGGRTPVAGMVHALVILFVLLVAGGLAGALALPALAAVLLVTAANMAE
PEKWREHWSLPWDERLLLLLTLFLTVFADLTIAIGVGVALGLLLRWWKGARTALWTPRER
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcgccggcccaaattgctcgatacgatgcgcgactatagctggcagctgtttcgtgcc
gacgcattagccggcatcagcgtcgctctcgtcgcattgccgctgtgcatcgccattgcc
atcgcatcgggcagcacgcccttcgtcgggctcgtcactgcaatcatcggcgggtttgtc
atttcattgacgagtggcagccgggtacagatcggcgggccgaccggggccttcattgtc
gtcgtatatggcgtgatccaggatcacgggatggacgggctgatcgtcgcaacgatcatg
gccggactgatcctgatccttgcgggctatttccgtgcggggcggctgattgcgctgatc
ccagaggcggtgatcaacggcttcaccatcgggatcgctgccatcattgccgcgagccag
ctggccgatgcgatggggttatcggcaggcaaggttcctgccgacatgatccccaagatc
gaggcgctgtgggccgcgcgcgcatcgttcagtggcattgcctttgcggtcacggcggtg
acaatcgcggccatcctcctgcttcgtcgctggcgtccgcgctggccggtgctcgtgatc
gcggtgggtgccgcctcgctcgcggttctctcgctcaacctgccggtcgatacggtgggc
tcgcggttcggcgcgctgccgagcggtctgcccgcgccccactggccgcaggtgacgttg
gagcgattggccgaactcctcccttctgcgctgaccatcgcctttcttgccggggtcgaa
tcgctgctttcagcgatcgtcgccgaccgcatgttcggcggccagcaccggccaagtgcc
gaactgctcgcgcaaggctacgccaatgtcctcacgccgctgttcggcggtctgcctgtg
acgggcgcgatcgcgcgcacagcgaccaatgtccgcgccggcgggcggacaccggtggcg
ggaatggtgcacgcgcttgtgatcctgtttgtgctcctcgtcgccggtgggctcgcgggt
gcgctggctttgcccgcgctcgccgcggtgctgctcgtgacggccgccaatatggcggag
cccgaaaaatggcgcgagcactggtcgctgccgtgggacgagcggctgttgttgctgctc
accctgttcctcactgtctttgccgacctgacgatcgcgatcggtgtgggggttgccttg
gggcttttgctccgctggtggaaaggcgcgcgcacggccctctggacgccgcgcgagcgc
tag

DBGET integrated database retrieval system